Retour
Explorez tous les épisodes du podcast Listen with Other
Plongez dans la liste complète des épisodes de Listen with Other. Chaque épisode est catalogué accompagné de descriptions détaillées, ce qui facilite la recherche et l'exploration de sujets spécifiques. Suivez tous les épisodes de votre podcast préféré et ne manquez aucun contenu pertinent.
| Titre | Date | Durée | |
|---|---|---|---|
| S09E06 The Mind Children: Now is the Month of Maying | 17 Jul 2026 | 00:22:21 | |
Episode 6 of 6.
Bob and Dave finally crack the code and the typescript reveals the shocking conclusion the forgotten TV series never reached.
It was written, read and mixed by Giles Booth who also arranged the opening Listen with Mother theme and synth version of ‘The Merry Month of Maying’.
The choir version of Now is the Month of Maying was performed by the Tudor Choristers Virtual Choir, directed by Dr Kathleen McGuire and recorded in May 2020 during the Corona Virus lock down. Visit the Tudor Choristers at https://www.tudorchoristers.org.au/
The solo version of Now is the Month of Maying was performed by Georgina Harland.
Other original music by Lee Sparey.
© and ℗ 2026 Giles Booth.
The cipher text mentioned in the show is as follows: LUDQCMSYFQGAAHEMXPCKYAYMIZSZZTGVTIQGZOKQKNKFSTDKBYMZQGSTLHQHSWWFCZOSIOKDPOIOYKQHKFUKPNIOZOHQFTGVCAGKYQHQCFHLPYFQAYTPFQLHACSGPUHINWKFHFZOHKXLFQLHTNACSTHQEFNWNITCDKKESGZOGQIHYKKFYNLTBNHRCFAYOIPLSXQBOSIOAYORQYAKSTZOFALOFVQHSWWFVYQXWIKGQYYOHAFEMVQGCFVYTDCKSNTINPIOGAMDCOPDTZCFQYSGZOFAYOMEIAMKKFBGFQKOZTCNUKSNZOCAMEEFXDTPTZCFHTFLLTZOCKQWKNKEMZQGYKORFTGVCAGKYQKENRNHMPORBLHRCFFPPCGQAGPGPLAHMNOSCFCPSGECKNYSGKLCNMKCNMNTIKISKEEFDQNISNDQZOCKPFPLACQDQFQFAKYKGA
| |||
| S09E05 The Mind Children: The Short-Trousered Racketeer | 12 Jul 2026 | 00:14:40 | |
Episode 5 of 6.
The Mind Children unexpectedly take the side of a school bully, and Bob and Dave get closer to cracking the code that will unlock the mystery of what happened to the forgotten TV show’s author.
Original music by Lee Sparey.
Script and audio mix © and ℗ 2026 Giles Booth.
The cipher text mentioned in the show is as follows: LUDQCMSYFQGAAHEMXPCKYAYMIZSZZTGVTIQGZOKQKNKFSTDKBYMZQGSTLHQHSWWFCZOSIOKDPOIOYKQHKFUKPNIOZOHQFTGVCAGKYQHQCFHLPYFQAYTPFQLHACSGPUHINWKFHFZOHKXLFQLHTNACSTHQEFNWNITCDKKESGZOGQIHYKKFYNLTBNHRCFAYOIPLSXQBOSIOAYORQYAKSTZOFALOFVQHSWWFVYQXWIKGQYYOHAFEMVQGCFVYTDCKSNTINPIOGAMDCOPDTZCFQYSGZOFAYOMEIAMKKFBGFQKOZTCNUKSNZOCAMEEFXDTPTZCFHTFLLTZOCKQWKNKEMZQGYKORFTGVCAGKYQKENRNHMPORBLHRCFFPPCGQAGPGPLAHMNOSCFCPSGECKNYSGKLCNMKCNMNTIKISKEEFDQNISNDQZOCKPFPLACQDQFQFAKYKGA
| |||
| S09E04 The Mind Children: The Death of the Author | 06 Jul 2026 | 00:20:24 | |
Episode 4 of 6.
The Mind Children are back! Bob and Dave get their hands on a typescript of the unbroadcast final three episodes. In episode 4 The Mind Children conduct an experiment in social and mental engineering at the school Christmas fair.
Original music by Lee Sparey.
Script and audio mix © and ℗ 2026 Giles Booth.
The cipher text mentioned in the show is as follows: LUDQCMSYFQGAAHEMXPCKYAYMIZSZZTGVTIQGZOKQKNKFSTDKBYMZQGSTLHQHSWWFCZOSIOKDPOIOYKQHKFUKPNIOZOHQFTGVCAGKYQHQCFHLPYFQAYTPFQLHACSGPUHINWKFHFZOHKXLFQLHTNACSTHQEFNWNITCDKKESGZOGQIHYKKFYNLTBNHRCFAYOIPLSXQBOSIOAYORQYAKSTZOFALOFVQHSWWFVYQXWIKGQYYOHAFEMVQGCFVYTDCKSNTINPIOGAMDCOPDTZCFQYSGZOFAYOMEIAMKKFBGFQKOZTCNUKSNZOCAMEEFXDTPTZCFHTFLLTZOCKQWKNKEMZQGYKORFTGVCAGKYQKENRNHMPORBLHRCFFPPCGQAGPGPLAHMNOSCFCPSGECKNYSGKLCNMKCNMNTIKISKEEFDQNISNDQZOCKPFPLACQDQFQFAKYKGA
| |||
| S09E03 The Mind Children: Framed | 29 May 2026 | 00:21:08 | |
Episode 3 of 6.
Dave is contacted by a listener and drives to deepest Somerset on the trail of the elusive creator of The Mind Children.
Original music by Lee Sparey.
Script and audio mix © and ℗ 2026 Giles Booth.
| |||
| S09E02 The Mind Children: The Playing Fields of England | 25 May 2026 | 00:15:08 | |
Episode 2 of 6.
Bob and Dave explore episode two of The Mind Children TV show, which tackled the subject of abuse at a boarding school. Then a listener contacts Dave with some extraordinary information about the series' enigmatic creator.
Original music by Lee Sparey.
Script and audio mix © and ℗ 2026 Giles Booth.
| |||
| S09E01 The Mind Children: Toxic Shock | 24 May 2026 | 00:23:04 | |
Episode 1 of 6.
Bob and Dave are the only people who remember a lost 1970s children's TV show called The Mind Children. Reconnected after forty years by social media, the childhood friends start to investigate why it was cancelled after only three episodes, and what happened to its elusive creator.
Original music by Lee Sparey.
Script and audio mix © and ℗ 2026 Giles Booth.
| |||
| S08E06 Tomorrow Never Knows: The Network | 03 May 2026 | 00:16:16 | |
Episode 6 of 6.
As the big vote approaches, Kim makes a discovery about her family.
Written, read and mixed by Giles Booth.
Original music by Lee Sparey.
© and ℗ 2026 Giles Booth.
| |||
| S08E05 Tomorrow Never Knows: Many Happy Returns | 02 May 2026 | 00:15:00 | |
Episode 5 of 6.
It's Kim's birthday and Roland has an unusual gift for her.
Written, read and mixed by Giles Booth.
Original music by Lee Sparey.
© and ℗ 2026 Giles Booth.
| |||
| S08E04 Tomorrow Never Knows: The Besomway | 28 Apr 2026 | 00:17:00 | |
Episode 4 of 6.
Roland helps Kim hatch a plan to escape the island using an ancient path across the mud.
Written, read and mixed by Giles Booth.
Original music by Lee Sparey.
© and ℗ 2026 Giles Booth.
| |||
| S08E03 Tomorrow Never Knows: The Silent Three | 23 Apr 2026 | 00:16:00 | |
Episode 3 of 6.
As Kim's stay on the island is extended she makes friends with two children who help her understand more about what's really going on, on the island and beyond.
Written, read and mixed by Giles Booth.
Original music by Lee Sparey.
© and ℗ 2026 Giles Booth.
| |||
| S08E02 Tomorrow Never Knows: The Island | 19 Apr 2026 | 00:16:14 | |
Episode 2 of 6.
Kim arrives on the island, meets her grandfather who lives in the castle, and discovers the place is not quite as welcoming as she remembered it.
Written, read and mixed by Giles Booth.
Original music by Lee Sparey.
© and ℗ 2026 Giles Booth.
| |||
| S08E01 Tomorrow Never Knows: The Bookshop | 16 Apr 2026 | 00:17:21 | |
Episode 1 of 6.
Kim never knew her mother. She lives above the town bookshop with her father, dreaming of a time when rationing will end. When her father is called away, she is on the cusp of discovering more about her family, and the world around her.
Written, read and mixed by Giles Booth.
Original music by Lee Sparey.
© and ℗ 2026 Giles Booth.
| |||
| Listen with Other: new story trailer | 11 Apr 2026 | 00:01:50 | |
Coming soon to Listen with Other, a new six-part story: TOMORROW NEVER KNOWS. | |||
| S07 Ep1 Hello World: The Curator | 17 Mar 2026 | 00:12:13 | |
Episode 1 of 3.
When Andrew's wife dies, he decides to take a short lease on a cottage in a fishing village in Cornwall to try to come to terms with his loss. He meets the curator of the eccentric local museum he and his wife had first discovered many years before.
Cover image of Puck public domain, from Fun magazine, 2nd September 1865 via Hathi Trust.
Written, read and mixed by Giles Booth.
Original music by Lee Sparey.
© and ℗ 2026 Giles Booth.
| |||
| S07 Ep2 Hello World: The Caretaker | 17 Mar 2026 | 00:09:28 | |
Episode 2 of 3.
Andrew meets the museum's caretaker and discovers its most valuable asset.
Written, read and mixed by Giles Booth.
Original music by Lee Sparey.
© and ℗ 2026 Giles Booth.
| |||
| S07 Ep3 Hello World: The Breakthrough | 17 Mar 2026 | 00:13:22 | |
Episode 3 of 3.
Andrew becomes obsessed with the ancient telegraph cable that lands on the beach and decides to see if it is still connected.
Written, read and mixed by Giles Booth.
Original music by Lee Sparey.
© and ℗ 2026 Giles Booth.
| |||
| S06 Ep1 Esprit de Corpse: Smells like Team Spirit | 08 Mar 2026 | 00:16:33 | |
Episode 1 of 3.
Go back in time to the early 2000s when the staff of a tiny British computer company are struggling to produce a new personal digital assistant called the MagicSlate. Join these four conflicting forces on a team-building exercise which has unintended consequences in every direction.
Written, read and mixed by Giles Booth.
© and ℗ 2026 Giles Booth.
| |||
| S06 Ep2 Esprit de Corpse: Swamp Thing | 08 Mar 2026 | 00:15:46 | |
Episode 2 of 3.
The four colleagues face their first team-building challenge of the day: work together to navigate a swamp.
Theme music arranged by Giles Booth. Incidental music © Lee Sparey.
Written, read and mixed by Giles Booth.
© and ℗ 2026 Giles Booth.
| |||
| S06 Ep3 Esprit de Corpse: The Hut in the Woods | 08 Mar 2026 | 00:17:49 | |
Episode 3 of 3.
Tempers fray as the four colleagues are split into two teams to embark on a treasure hunt.
Theme music arranged by Giles Booth. Incidental music © Lee Sparey.
Written, read and mixed by Giles Booth.
© and ℗ 2026 Giles Booth.
| |||
| S05 The Interchange by Ray Newman | 10 Feb 2026 | 00:16:12 | |
Episode 1 of 1.
Guest author Ray Newman, author of Municipal Gothic and Intervals of Darkness, reads a new story: The Interchange. Nobody knows who built the new exit road at Old Barn roundabout near the motorway interchange, when, or why. What is certain is that anybody who drives that way disappears.
Every attempt by the authorities to investigate only raises more questions, and suggests new and more sinister possibilities. Story and original music © 2026 Ray Newman. Episode mix ℗ 2026 Giles Booth.
| |||
| S04 Ep01 The Curious Case of Room 623: A researcher calls. | 01 Feb 2026 | 00:10:00 | |
Episode 1 of 3. Enter the world of an enigmatic academic, hidden at the top of a dilapidated brutalist concrete university tower, a professor of paranormal computing, looking for patterns in random noise, and debunking stories of the unexplained.
A persistent podcast researcher interrupts their near-solitude, leading to an investigation of a legend surrounding the fate of any student unlucky enough to be assigned room 623.
Content warning: contains references to suicide.
| |||
| S04 Ep02 The Curious Case of Room 623: Knock three times | 01 Feb 2026 | 00:10:05 | |
Episode 2 of 3. The professor goes in search of the real room 623.
Content warning: contains references to suicide.
| |||
| S04 Ep03 The Curious Case of Room 623: Wrong number | 01 Feb 2026 | 00:08:43 | |
Episode 3 of 3. The professor gets a wrong number. Is it a prank - or something more sinister?
Content warning: contains references to suicide.
| |||
| S03 Ep02 The Ring O'Bells: Two Suits | 06 Jan 2026 | 00:10:00 | |
Episode 2 of 2. Two strangers attempt to unravel the mystery of the Ring O'Bells.
| |||
| S03 Ep01 The Ring O'Bells: Ouija Board, Ouija Board | 06 Jan 2026 | 00:09:30 | |
Episode 1 of 2. Discover how 1970s family Ouija board sessions come back to haunt our narrator in the present day.
| |||
| S02 Ep04 No Service: Last Christmas | 21 Dec 2025 | 00:06:29 | |
Episode 4 of 4. Christmas Day does not quite go to plan.
| |||
| S02 Ep03 No Service: The Attic Room | 21 Dec 2025 | 00:08:06 | |
Episode 3 of 4. Lucy and Tom explore a strange room in the loft.
| |||
| S02 Ep02 No Service: Lucy and Tom at Christmas | 21 Dec 2025 | 00:07:17 | |
Episode 2 of 4. Lucy and Tom's first day in the cottage takes a strange turn.
| |||
| S02 Ep01 No Service: Worst Christmas Ever | 21 Dec 2025 | 00:07:14 | |
Episode 1 of 4. Lucy and Tom reluctantly go away for Christmas with their dad and his girlfriend.
| |||
| S01 Ep03 The Merry Milkmaids | 27 Sep 2025 | 00:12:00 | |
Episode 3 of 3. The trio meet some merry milkmaids and have a life-changing experience.
| |||
| S01 Ep02 The Merry Milkmaids: A shot rang out | 27 Sep 2025 | 00:19:14 | |
Episode 2 of 3. An unexpected visitor interrupts Kate and Ian's getaway.
| |||
| S01 Ep01 The Merry Milkmaids: Get Out of London | 27 Sep 2025 | 00:13:30 | |
Episode 1 of 3. Kate's birthday fell just after new year so it was always a struggle finding people in the mood to party. Hoping to exorcise the memory of a disastrous birthday party five years ago, her husband lan books a getaway in rural Somerset. Unfinished business with Margate Louise, a friend they lost touch with, a storm called Arthur and a stone circle that is not what it seems, ensure that this new year and birthday do not go to plan...
| |||
© My Podcast Data · Projet indépendant · Données issues d'Apple & Spotify